C16orf13 (METTL26) (NM_032366) Human Mass Spec Standard

CAT#: PH318337

C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_115742)

Product Images

Coomassie blue staining of purified METTL26 protein (Cat# TP318337). The protein was produced from HEK293T cells transfected with METTL26 cDNA clone (Cat# RC218337) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218337
• Predicted MW: 22.4 kDa
• Protein Sequence:
  Sequence Link

  >RC218337 representing NM_032366
  Red=Cloning site Green=Tags(s)
  
  MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDSIAAT
  TQAQGLTNVKAPLHLDVTWGWEHWGGILPQSLDLLLCINMAHVSPLRCTEGLFRAAGHLLKPRALLITYG
  PYAINGKISPQSNVDFDLMLRCRNPEWGLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115742
• RefSeq Size: 854
• RefSeq ORF: 612
• Synonyms: C16orf13; JFP2
• Locus ID: 84326
• UniProt ID: Q96S19
• Cytogenetics: 16p13.3