MST3 (STK24) (NM_003576) Human Mass Spec Standard

CAT#: PH317776

STK24 MS Standard C13 and N15-labeled recombinant protein (NP_003567)

Product Images

Coomassie blue staining of purified STK24 protein (Cat# TP317776). The protein was produced from HEK293T cells transfected with STK24 cDNA clone (Cat# RC217776) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217776
• Predicted MW: 49.1 kDa
• Protein Sequence:
  Sequence Link

  >RC217776 representing NM_003576
  Red=Cloning site Green=Tags(s)
  
  MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLE
  EAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI
  LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQLAYDS
  KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKEL
  LKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLE
  NGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISD
  TMVAQLVQRLQRYSLSGGGTSSH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003567
• RefSeq Size: 4539
• RefSeq ORF: 1329
• Synonyms: HEL-S-95; MST3; MST3B; STE20; STK3
• Locus ID: 8428
• UniProt ID: Q9Y6E0
• Cytogenetics: 13q32.2
• Summary: This gene encodes a serine/threonine protein kinase that functions upstream of mitogen-activated protein kinase (MAPK) signaling. The encoded protein is cleaved into two chains by caspases; the N-terminal fragment (MST3/N) translocates to the nucleus and promotes programmed cells death. There is a pseudogene for this gene on chromosome X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
• Protein Families: Druggable Genome, Protein Kinase