PKIB (NM_181794) Human Mass Spec Standard
CAT#: PH316291
PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861459)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216291 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC216291 protein sequence
Red=Cloning site Green=Tags(s) MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL EKPQNEEK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_861459 |
RefSeq Size | 1892 |
RefSeq ORF | 234 |
Synonyms | PRKACN2 |
Locus ID | 5570 |
UniProt ID | Q9C010 |
Cytogenetics | 6q22.31 |
Summary | This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405587 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405588 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC410103 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405587 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2 |
USD 436.00 |
|
LY405588 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1 |
USD 436.00 |
|
LY410103 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3 |
USD 436.00 |
|
PH312372 | PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861460) |
USD 3,255.00 |
|
TP312372 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1, 20 µg |
USD 867.00 |
|
TP316291 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2, 20 µg |
USD 867.00 |
|
TP720220 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3 |
USD 330.00 |
|
TP761370 | Purified recombinant protein of Human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review