HELT (NM_001029887) Human Mass Spec Standard

CAT#: PH315012

HELT MS Standard C13 and N15-labeled recombinant protein (NP_001025058)

Product Images

Coomassie blue staining of purified HELT protein (Cat# TP315012). The protein was produced from HEK293T cells transfected with HELT cDNA clone (Cat# RC215012) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215012
• Predicted MW: 35.6 kDa
• Protein Sequence:
  Sequence Link

  >RC215012 representing NM_001029887
  Red=Cloning site Green=Tags(s)
  
  MSDKLKERKVSRLSPNGTCALVVEASDSPTRHLGGPMAGKCPHGTLSVEESRVRTPVSHKVIEKRRRDRI
  NRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPDQQALGRCEGPFLLLQSSGKLEKAEIL
  EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSK
  ARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAP
  VPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001025058
• RefSeq Size: 984
• RefSeq ORF: 981
• Synonyms: bHLHb44; HCM1228; HESL; Mgn
• Locus ID: 391723
• UniProt ID: A6NFD8
• Cytogenetics: 4q35.1
• Summary: Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'.[UniProtKB/Swiss-Prot Function]