PAX8 (NM_013953) Human Mass Spec Standard
CAT#: PH314188
PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_039247)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214188 |
Predicted MW | 34.7 kDa |
Protein Sequence |
>RC214188 representing NM_013953
Red=Cloning site Green=Tags(s) MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWWGPRCPDTHPTSPPADR AAMPPLPSQAWWQEVNTLAMPMATPPTPPTARPGASPTPAC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_039247 |
RefSeq Size | 3755 |
RefSeq ORF | 963 |
Locus ID | 7849 |
UniProt ID | Q06710, A0A024R4X8 |
Cytogenetics | 2q14.1 |
Summary | This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401173 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC415550 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC415551 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC415574 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC429402 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401173 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A |
USD 436.00 |
|
LY415550 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8C |
USD 436.00 |
|
LY415551 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8D |
USD 436.00 |
|
LY415574 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8E |
USD 436.00 |
|
PH300651 | PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_003457) |
USD 3,255.00 |
|
PH315690 | PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_054698) |
USD 3,255.00 |
|
TP300651 | Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A, 20 µg |
USD 867.00 |
|
TP314188 | Purified recombinant protein of Homo sapiens paired box 8 (PAX8), transcript variant PAX8D, 20 µg |
USD 867.00 |
|
TP315690 | Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8E, 20 µg |
USD 867.00 |
|
TP762414 | Purified recombinant protein of Human paired box 8 (PAX8), transcript variant PAX8A, Cys238-End, with N-terminal His tag, expressed in E.coli, 50ug |
USD 249.00 |
{0} Product Review(s)
Be the first one to submit a review