DNAJB13 (NM_153614) Human Mass Spec Standard
CAT#: PH314119
DNAJB13 MS Standard C13 and N15-labeled recombinant protein (NP_705842)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214119 |
Predicted MW | 35.9 kDa |
Protein Sequence |
>RC214119 representing NM_153614
Red=Cloning site Green=Tags(s) MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEE GLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQV ERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPAD IIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPL PEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_705842 |
RefSeq Size | 1875 |
RefSeq ORF | 948 |
Synonyms | CILD34; RSPH16A; TSARG5; TSARG6 |
Locus ID | 374407 |
UniProt ID | P59910 |
Cytogenetics | 11q13.4 |
Summary | This gene encodes a member of the heat shock protein 40 co-chaperone family which is produced in large amounts in the testis and is located on the radial spokes of the axoneme in human sperm flagella and other flagellar structures. The encoded protein associates with the sperm annulus, as part of the septin complex, through direct interaction with septin 4, during sperm terminal differentiation. Naturally occurring mutations in this gene are associated with primary ciliary dyskinesia and male infertility. [provided by RefSeq, Apr 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406985 | DNAJB13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406985 | Transient overexpression lysate of DnaJ (Hsp40) related, subfamily B, member 13 (DNAJB13) |
USD 436.00 |
|
TP314119 | Recombinant protein of human DnaJ (Hsp40) related, subfamily B, member 13 (DNAJB13), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review