C2orf88 (NM_001042520) Human Mass Spec Standard

CAT#: PH313362

C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985)

Product Images

Coomassie blue staining of purified C2orf88 protein (Cat# TP313362). The protein was produced from HEK293T cells transfected with C2orf88 cDNA clone (Cat# RC213362) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213362
• Predicted MW: 11 kDa
• Protein Sequence:
  Sequence Link

  >RC213362 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDIL
  CDALQQWACNNIKYHDIPYIESEGP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035985
• RefSeq Size: 4007
• RefSeq ORF: 285
• Synonyms: smAKAP
• Locus ID: 84281
• UniProt ID: Q9BSF0
• Cytogenetics: 2q32.2
• Summary: Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.[UniProtKB/Swiss-Prot Function]