TIP30 (HTATIP2) (NM_001098522) Human Mass Spec Standard
CAT#: PH312332
HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001091992)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212332 |
Predicted MW | 27.1 kDa |
Protein Sequence |
>RC212332 protein sequence
Red=Cloning site Green=Tags(s) MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAM LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001091992 |
RefSeq Size | 1719 |
RefSeq ORF | 726 |
Synonyms | CC3; SDR44U1; TIP30 |
Locus ID | 10553 |
UniProt ID | Q9BUP3 |
Cytogenetics | 11p15.1 |
Summary | Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416670 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420619 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420620 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420621 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416670 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2 |
USD 436.00 |
|
LY420619 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 3 |
USD 436.00 |
|
LY420620 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4 |
USD 436.00 |
|
LY420621 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 5 |
USD 436.00 |
|
PH300276 | HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_006401) |
USD 3,255.00 |
|
TP300276 | Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2, 20 µg |
USD 867.00 |
|
TP312332 | Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review