TIP30 (HTATIP2) (NM_001098522) Human Mass Spec Standard

CAT#: PH312332

HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001091992)

Product Images

Coomassie blue staining of purified HTATIP2 protein (Cat# TP312332). The protein was produced from HEK293T cells transfected with HTATIP2 cDNA clone (Cat# RC212332) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212332
• Predicted MW: 27.1 kDa
• Protein Sequence:
  Sequence Link

  >RC212332 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV
  DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN
  FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAM
  LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001091992
• RefSeq Size: 1719
• RefSeq ORF: 726
• Synonyms: CC3; SDR44U1; TIP30
• Locus ID: 10553
• UniProt ID: Q9BUP3
• Cytogenetics: 11p15.1
• Summary: Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome