ORC4L (ORC4) (NM_181741) Human Mass Spec Standard
CAT#: PH311723
ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_859525)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211723 |
Predicted MW | 50.2 kDa |
Protein Sequence |
>RC211723 representing NM_181741
Red=Cloning site Green=Tags(s) MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRG SGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLL EALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRF SHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLH MLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVY NEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN CPTDVRQWATSSLSWL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_859525 |
RefSeq Size | 2793 |
RefSeq ORF | 1308 |
Synonyms | ORC4L; ORC4P |
Locus ID | 5000 |
UniProt ID | O43929 |
Cytogenetics | 2q23.1 |
Summary | The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene. [provided by RefSeq, Oct 2010] |
Protein Pathways | Cell cycle |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405645 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC405646 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC419257 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC433812 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405645 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1 |
USD 665.00 |
|
LY405646 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3 |
USD 665.00 |
|
LY419257 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2 |
USD 436.00 |
|
LY433812 | Transient overexpression lysate of origin recognition complex, subunit 4 (ORC4), transcript variant 5 |
USD 436.00 |
|
PH301587 | ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_002543) |
USD 3,255.00 |
|
PH311713 | ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_859526) |
USD 3,255.00 |
|
TP301587 | Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2, 20 µg |
USD 867.00 |
|
TP311713 | Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3, 20 µg |
USD 867.00 |
|
TP311723 | Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review