SLURP2 (NM_177458) Human Mass Spec Standard

CAT#: PH311711

LYNX1 MS Standard C13 and N15-labeled recombinant protein (NP_803253)

Product Images

Coomassie blue staining of purified SLURP2 protein (Cat# TP311711). The protein was produced from HEK293T cells transfected with SLURP2 cDNA clone (Cat# RC211711) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211711
• Predicted MW: 10 kDa
• Protein Sequence:
  Sequence Link

  >RC211711 representing NM_177458
  Red=Cloning site Green=Tags(s)
  
  MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHI
  GCPDIPSLGLGPYVSIACCQTSLCNHD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_803253
• RefSeq Size: 589
• RefSeq ORF: 291
• Synonyms: SLURP-2
• Locus ID: 432355
• UniProt ID: P0DP57
• Cytogenetics: 8q24.3
• Summary: This gene encodes a novel, secreted member of the Ly6/uPAR (LU) superfamily of proteins containing the unique three-finger LU domain. This gene is mainly expressed in epithelial cells, including skin and keratinocytes, and is up-regulated in psoriatic skin lesions, suggesting its involvement in the pathophysiology of psoriasis. Alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (LYNX1) generates naturally-occurring transcripts (LYNX1-SLURP2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Sep 2017]