C20orf79 (SCP2D1) (NM_178483) Human Mass Spec Standard

CAT#: PH311269

C20orf79 MS Standard C13 and N15-labeled recombinant protein (NP_848578)

Product Images

Coomassie blue staining of purified SCP2D1 protein (Cat# TP311269). The protein was produced from HEK293T cells transfected with SCP2D1 cDNA clone (Cat# RC211269) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211269
• Predicted MW: 17.7 kDa
• Protein Sequence:
  Sequence Link

  >RC211269 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVF
  QLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKV
  LLSWKLERVFKDWAKF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_848578
• RefSeq Size: 677
• RefSeq ORF: 468
• Synonyms: C20orf79; dJ1068E13.2; HSD22
• Locus ID: 140856
• UniProt ID: Q9UJQ7
• Cytogenetics: 20p11.23