gamma Tubulin (TUBG2) (NM_016437) Human Mass Spec Standard

CAT#: PH311127

TUBG2 MS Standard C13 and N15-labeled recombinant protein (NP_057521)

Product Images

Coomassie blue staining of purified TUBG2 protein (Cat# TP311127). The protein was produced from HEK293T cells transfected with TUBG2 cDNA clone (Cat# RC211127) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211127
• Predicted MW: 51.1 kDa
• Protein Sequence:
  Sequence Link

  >RC211127 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE
  PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS
  IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL
  NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ
  SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP
  WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDE
  MDRSREVVQELIDEYHAATQPDYISWGTQEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057521
• RefSeq Size: 1841
• RefSeq ORF: 1353
• Locus ID: 27175
• UniProt ID: Q9NRH3
• Cytogenetics: 17q21.2
• Summary: Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta chain minus-end nucleation, centrosome duplication and spindle formation (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome