NECAP1 (NM_015509) Human Mass Spec Standard
CAT#: PH311100
NECAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056324)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211100 |
Predicted MW | 29.7 kDa |
Protein Sequence |
>RC211100 protein sequence
Red=Cloning site Green=Tags(s) MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFA QAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKES QEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHV TPPPIPKSNHGGSDADILLDLDSPAPVTTPAPTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056324 |
RefSeq Size | 2600 |
RefSeq ORF | 825 |
Synonyms | DEE21; EIEE21 |
Locus ID | 25977 |
UniProt ID | Q8NC96 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes a protein containing two characteristic WXXF motifs. The encoded protein localizes to clathrin-coated vesicles, where it binds components of the adapter protein complexes and aids in endocytosis. Loss of function of this gene results in early infantile epileptic encephalopathy-21. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414502 | NECAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414502 | Transient overexpression lysate of NECAP endocytosis associated 1 (NECAP1), transcript variant 1 |
USD 436.00 |
|
TP311100 | Recombinant protein of human NECAP endocytosis associated 1 (NECAP1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review