Lactate Dehydrogenase C (LDHC) (NM_017448) Human Mass Spec Standard
CAT#: PH310627
LDHC MS Standard C13 and N15-labeled recombinant protein (NP_059144)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210627 |
Predicted MW | 36.3 kDa |
Protein Sequence |
>RC210627 protein sequence
Red=Cloning site Green=Tags(s) MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_059144 |
RefSeq Size | 1264 |
RefSeq ORF | 996 |
Synonyms | CT32; LDH3; LDHX |
Locus ID | 3948 |
UniProt ID | P07864, A0A140VKA7 |
Cytogenetics | 11p15.1 |
Summary | Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq, Jul 2008] |
Protein Pathways | Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400837 | LDHC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC413747 | LDHC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400837 | Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 1 |
USD 436.00 |
|
LY413747 | Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 2 |
USD 436.00 |
|
PH309516 | LDHC MS Standard C13 and N15-labeled recombinant protein (NP_002292) |
USD 3,255.00 |
|
TP309516 | Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 1, 20 µg |
USD 867.00 |
|
TP310627 | Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review