RPA4 (NM_013347) Human Mass Spec Standard
CAT#: PH310239
RPA4 MS Standard C13 and N15-labeled recombinant protein (NP_037479)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210239 |
Predicted MW | 28.9 kDa |
Protein Sequence |
>RC210239 protein sequence
Red=Cloning site Green=Tags(s) MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGII VSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSL EVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIH ECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_037479 |
RefSeq Size | 1560 |
RefSeq ORF | 783 |
Synonyms | HSU24186 |
Locus ID | 29935 |
UniProt ID | Q13156 |
Cytogenetics | Xq21.33 |
Summary | This gene encodes a single-stranded DNA-binding protein that is the 30-kDa subunit of the replication protein A complex. Replication protein A is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. The encoded protein localizes to DNA repair foci and may be involved in the cellular DNA damage response. This protein may also play a role in inhibiting viral replication.[provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome |
Protein Pathways | DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415651 | RPA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415651 | Transient overexpression lysate of replication protein A4, 34kDa (RPA4) |
USD 436.00 |
|
TP310239 | Recombinant protein of human replication protein A4, 34kDa (RPA4), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review