RELM beta (RETNLB) (NM_032579) Human Mass Spec Standard

CAT#: PH310104

RETNLB MS Standard C13 and N15-labeled recombinant protein (NP_115968)

Product Images

Coomassie blue staining of purified RETNLB protein (Cat# TP310104). The protein was produced from HEK293T cells transfected with RETNLB cDNA clone (Cat# RC210104) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210104
• Predicted MW: 11.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210104 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAG
  MAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115968
• RefSeq Size: 594
• RefSeq ORF: 333
• Synonyms: FIZZ1; FIZZ2; HXCP2; RELM-beta; RELMb; RELMbeta; XCP2
• Locus ID: 84666
• UniProt ID: Q9BQ08
• Cytogenetics: 3q13.13
• Summary: Probable hormone.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein