MSC (NM_005098) Human Mass Spec Standard
CAT#: PH309818
MSC MS Standard C13 and N15-labeled recombinant protein (NP_005089)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209818 |
Predicted MW | 22.1 kDa |
Protein Sequence |
>RC209818 protein sequence
Red=Cloning site Green=Tags(s) MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGC KRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPD TKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPDSDTKEVSAANRLCGTTA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005089 |
RefSeq Size | 2075 |
RefSeq ORF | 618 |
Synonyms | ABF-1; ABF1; bHLHa22; MYOR |
Locus ID | 9242 |
UniProt ID | O60682 |
Cytogenetics | 8q13.3 |
Summary | The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417513 | MSC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417513 | Transient overexpression lysate of musculin (activated B-cell factor-1) (MSC) |
USD 436.00 |
|
TP309818 | Recombinant protein of human musculin (activated B-cell factor-1) (MSC), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review