TMEM35 (TMEM35A) (NM_021637) Human Mass Spec Standard

CAT#: PH309790

TMEM35 MS Standard C13 and N15-labeled recombinant protein (NP_067650)

Product Images

Coomassie blue staining of purified TMEM35A protein (Cat# TP309790). The protein was produced from HEK293T cells transfected with TMEM35A cDNA clone (Cat# RC209790) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209790
• Predicted MW: 18.4 kDa
• Protein Sequence:
  Sequence Link

  >RC209790 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGA
  LEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSS
  EKKPLPGNAEEQPSLYEKAPQGKVKVS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067650
• RefSeq Size: 2086
• RefSeq ORF: 501
• Synonyms: NACHO; TMEM35; TUF-1
• Locus ID: 59353
• UniProt ID: Q53FP2
• Cytogenetics: Xq22.1
• Summary: A soluble peptide released by shedding may interact with NGFR and modulate neurite outgrowth.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane