OTUB2 (NM_023112) Human Mass Spec Standard
CAT#: PH309650
OTUB2 MS Standard C13 and N15-labeled recombinant protein (NP_075601)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209650 |
Predicted MW | 27.2 kDa |
Protein Sequence |
>RC209650 protein sequence
Red=Cloning site Green=Tags(s) MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE AATPSVYLLYKTSHYNILYAADKH SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_075601 |
RefSeq Size | 3873 |
RefSeq ORF | 702 |
Synonyms | C14orf137; OTB2; OTU2 |
Locus ID | 78990 |
UniProt ID | Q96DC9 |
Cytogenetics | 14q32.12 |
Summary | This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. [provided by RefSeq, Aug 2011] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402958 | OTUB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402958 | Transient overexpression lysate of OTU domain, ubiquitin aldehyde binding 2 (OTUB2) |
USD 436.00 |
|
TP309650 | Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2), 20 µg |
USD 867.00 |
|
TP720215 | Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review