CNPY2 (NM_014255) Human Mass Spec Standard

CAT#: PH309441

CNPY2 MS Standard C13 and N15-labeled recombinant protein (NP_055070)

Product Images

Coomassie blue staining of purified CNPY2 protein (Cat# TP309441). The protein was produced from HEK293T cells transfected with CNPY2 cDNA clone (Cat# RC209441) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209441
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209441 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKGWGWLALLLGALLGTAWARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVP
  YARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSDISGTLKFACESI
  VEEYEDELIEFFSREADNVKDKLCSKRTDLCDHALHISHDEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055070
• RefSeq Size: 1247
• RefSeq ORF: 546
• Synonyms: HP10390; MSAP; TMEM4; ZSIG9
• Locus ID: 10330
• UniProt ID: Q9Y2B0
• Cytogenetics: 12q13.3
• Summary: Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.[UniProtKB/Swiss-Prot Function]