PPM1B (NM_177969) Human Mass Spec Standard
CAT#: PH309425
PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808908)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209425 |
Predicted MW | 52.6 kDa |
Protein Sequence |
>RC209425 protein sequence
Red=Cloning site Green=Tags(s) MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL PPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_808908 |
RefSeq Size | 1829 |
RefSeq ORF | 1440 |
Synonyms | PP2C-beta; PP2C-beta-X; PP2CB; PP2CBETA; PPC2BETAX |
Locus ID | 5495 |
UniProt ID | O75688 |
Cytogenetics | 2p21 |
Summary | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406063 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419156 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422387 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406063 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 2 |
USD 436.00 |
|
LY419156 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 1 |
USD 665.00 |
|
LY422387 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 4 |
USD 436.00 |
|
PH312918 | PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_002697) |
USD 3,255.00 |
|
PH322782 | PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808907) |
USD 3,255.00 |
|
TP309425 | Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 3, 20 µg |
USD 867.00 |
|
TP312918 | Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 1, 20 µg |
USD 867.00 |
|
TP322782 | Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review