COMMD5 (NM_014066) Human Mass Spec Standard

CAT#: PH309381

COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_054785)

Product Images

Coomassie blue staining of purified COMMD5 protein (Cat# TP309381). The protein was produced from HEK293T cells transfected with COMMD5 cDNA clone (Cat# RC209381) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209381
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209381 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR
  LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS
  VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE
  MADLEKRCERRLQD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054785
• RefSeq Size: 1475
• RefSeq ORF: 672
• Synonyms: HCARG; HT002
• Locus ID: 28991
• UniProt ID: Q9GZQ3
• Cytogenetics: 8q24.3
• Summary: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome