GATA2 (NM_032638) Human Mass Spec Standard
CAT#: PH308554
GATA2 MS Standard C13 and N15-labeled recombinant protein (NP_116027)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208554 |
Predicted MW | 50.5 kDa |
Protein Sequence |
>RC208554 protein sequence
Red=Cloning site Green=Tags(s) MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSV YPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDG VKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTP KQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_116027 |
RefSeq Size | 3383 |
RefSeq ORF | 1440 |
Synonyms | DCML; IMD21; MONOMAC; NFE1B |
Locus ID | 2624 |
UniProt ID | P23769 |
Cytogenetics | 3q21.3 |
Summary | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403182 | GATA2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428960 | GATA2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403182 | Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 2 |
USD 436.00 |
|
LY428960 | Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 1 |
USD 436.00 |
|
TP308554 | Recombinant protein of human GATA binding protein 2 (GATA2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review