OLIG2 (NM_005806) Human Mass Spec Standard

CAT#: PH308209

OLIG2 MS Standard C13 and N15-labeled recombinant protein (NP_005797)

Product Images

Coomassie blue staining of purified OLIG2 protein (Cat# TP308209). The protein was produced from HEK293T cells transfected with OLIG2 cDNA clone (Cat# RC208209) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208209
• Predicted MW: 32.2 kDa
• Protein Sequence:
  Sequence Link

  >RC208209 representing NM_005806
  Red=Cloning site Green=Tags(s)
  
  MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL
  GGSGFKXSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG
  PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH
  AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG
  ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005797
• RefSeq Size: 2505
• RefSeq ORF: 969
• Synonyms: BHLHB1; bHLHe19; OLIGO2; PRKCBP2; RACK17
• Locus ID: 10215
• UniProt ID: Q13516
• Cytogenetics: 21q22.11
• Summary: This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors