APJ Receptor (APLNR) (NM_005161) Human Mass Spec Standard
CAT#: PH307576
APLNR MS Standard C13 and N15-labeled recombinant protein (NP_005152)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207576 |
Predicted MW | 42.7 kDa |
Protein Sequence |
>RC207576 protein sequence
Red=Cloning site Green=Tags(s) MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIAS LAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARL RLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGF VVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWP CDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGH SQGPGPNMGKGGEQMHEKSIPYSQETLVVD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005152 |
RefSeq Size | 3905 |
RefSeq ORF | 1140 |
Synonyms | AGTRL1; APJ; APJR; HG11 |
Locus ID | 187 |
UniProt ID | P35414, B3KQN4, B2RDH3 |
Cytogenetics | 11q12.1 |
Summary | This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. [provided by RefSeq, Jul 2009] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401579 | APLNR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401579 | Transient overexpression lysate of apelin receptor (APLNR), transcript variant 1 |
USD 436.00 |
|
TP307576 | Recombinant protein of human apelin receptor (APLNR), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review