TRAPPC1 (NM_021210) Human Mass Spec Standard
CAT#: PH307483
TRAPPC1 MS Standard C13 and N15-labeled recombinant protein (NP_067033)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207483 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC207483 protein sequence
Red=Cloning site Green=Tags(s) MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK LHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFF SARAG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_067033 |
RefSeq Size | 837 |
RefSeq ORF | 435 |
Synonyms | BET5; MUM2 |
Locus ID | 58485 |
UniProt ID | Q9Y5R8 |
Cytogenetics | 17p13.1 |
Summary | This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412013 | TRAPPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432581 | TRAPPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412013 | Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 1 |
USD 436.00 |
|
LY432581 | Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 2 |
USD 436.00 |
|
TP307483 | Recombinant protein of human trafficking protein particle complex 1 (TRAPPC1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review