FAM229B (NM_001033564) Human Mass Spec Standard

CAT#: PH307382

C6orf225 MS Standard C13 and N15-labeled recombinant protein (NP_001028736)

Product Images

Coomassie blue staining of purified FAM229B protein (Cat# TP307382). The protein was produced from HEK293T cells transfected with FAM229B cDNA clone (Cat# RC207382) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207382
• Predicted MW: 8.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207382 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPP
  AQSSKEMHPK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001028736
• RefSeq Size: 2682
• RefSeq ORF: 240
• Synonyms: C6orf225
• Locus ID: 619208
• UniProt ID: Q4G0N7
• Cytogenetics: 6q21