UBE2D3 (NM_003340) Human Mass Spec Standard
CAT#: PH307371
UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_003331)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207371 |
Predicted MW | 16.7 kDa |
Protein Sequence |
>RC207371 protein sequence
Red=Cloning site Green=Tags(s) MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE WTQKYAM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003331 |
RefSeq Size | 3976 |
RefSeq ORF | 441 |
Synonyms | E2(17)KB3; UBC4/5; UBCH5C |
Locus ID | 7323 |
UniProt ID | P61077, A0A024RDH2 |
Cytogenetics | 4q24 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. [provided by RefSeq, Jan 2017] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405574 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405575 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405576 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405577 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405578 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405579 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405581 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418758 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405574 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2 |
USD 436.00 |
|
LY405575 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3 |
USD 436.00 |
|
LY405576 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 4 |
USD 436.00 |
|
LY405577 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5 |
USD 436.00 |
|
LY405578 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 6 |
USD 436.00 |
|
LY405579 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 7 |
USD 436.00 |
|
LY405581 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9 |
USD 436.00 |
|
LY418758 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1 |
USD 436.00 |
|
PH313585 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871615) |
USD 3,255.00 |
|
PH313686 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871618) |
USD 3,255.00 |
|
PH315841 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871616) |
USD 3,255.00 |
|
PH318977 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871622) |
USD 3,255.00 |
|
TP307371 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1, 20 µg |
USD 867.00 |
|
TP313585 | Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2, 20 µg |
USD 867.00 |
|
TP313686 | Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5, 20 µg |
USD 867.00 |
|
TP315841 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3, 20 µg |
USD 867.00 |
|
TP318977 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9, 20 µg |
USD 867.00 |
|
TP721151 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review