NDUFS6 (NM_004553) Human Mass Spec Standard

CAT#: PH307108

NDUFS6 MS Standard C13 and N15-labeled recombinant protein (NP_004544)

Product Images

Coomassie blue staining of purified NDUFS6 protein (Cat# TP307108). The protein was produced from HEK293T cells transfected with NDUFS6 cDNA clone (Cat# RC207108) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207108
• Predicted MW: 13.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207108 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAID
  LIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004544
• RefSeq Size: 554
• RefSeq ORF: 372
• Synonyms: CI-13kA; CI-13kD-A; CI13KDA; MC1DN9
• Locus ID: 4726
• UniProt ID: O75380, Q6IBC4
• Cytogenetics: 5p15.33
• Summary: This gene encodes a subunit of the NADH:ubiquinone oxidoreductase (complex I), which is the first enzyme complex in the electron transport chain of mitochondria. This complex functions in the transfer of electrons from NADH to the respiratory chain. The subunit encoded by this gene is one of seven subunits in the iron-sulfur protein fraction. Mutations in this gene cause mitochondrial complex I deficiency, a disease that causes a wide variety of clinical disorders, including neonatal disease and adult-onset neurodegenerative disorders.[provided by RefSeq, Oct 2009]
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease