Bcl G (BCL2L14) (NM_138722) Human Mass Spec Standard

CAT#: PH306404

BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620048)

Product Images

Coomassie blue staining of purified BCL2L14 protein (Cat# TP306404). The protein was produced from HEK293T cells transfected with BCL2L14 cDNA clone (Cat# RC206404) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206404
• Predicted MW: 36.6 kDa
• Protein Sequence:
  Sequence Link

  >RC206404 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEV
  SWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQC
  LEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILA
  KIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTA
  KLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620048
• RefSeq Size: 1886
• RefSeq ORF: 981
• Synonyms: BCLG
• Locus ID: 79370
• UniProt ID: Q9BZR8, A0A024RAR1
• Cytogenetics: 12p13.2
• Summary: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq, May 2009]
• Protein Families: Druggable Genome