CTRP5 (C1QTNF5) (NM_015645) Human Mass Spec Standard
CAT#: PH305968
C1QTNF5 MS Standard C13 and N15-labeled recombinant protein (NP_056460)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205968 |
Predicted MW | 25.3 kDa |
Protein Sequence |
>RC205968 representing NM_015645
Red=Cloning site Green=Tags(s) MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGR PGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVT GKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVG VGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056460 |
RefSeq Size | 3927 |
RefSeq ORF | 729 |
Synonyms | CTRP5; MFRP |
Locus ID | 114902 |
UniProt ID | Q9BXJ0, A0A024R3F8 |
Cytogenetics | 11q23.3 |
Summary | This gene encodes a member of a family of proteins that function as components of basement membranes and may play a role in cell adhesion. Mutations in this gene have been associated with late-onset retinal degeneration. The protein may be encoded by either a bicistronic transcript including sequence from the upstream membrane frizzled-related protein gene (MFRP), or by a monocistronic transcript expressed from an internal promoter. [provided by RefSeq, Jun 2013] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414426 | C1QTNF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414426 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 5 (C1QTNF5) |
USD 436.00 |
|
TP305968 | Purified recombinant protein of Homo sapiens C1q and tumor necrosis factor related protein 5 (C1QTNF5), 20 µg |
USD 867.00 |
|
TP701010 | Purified recombinant protein of Human C1q and tumor necrosis factor related protein 5 (C1QTNF5), mutant (S163R), expressed in HEK293 cells, 20ug |
USD 867.00 |
|
TP701081 | Purified recombinant protein of Human C1q and tumor necrosis factor related protein 5 (C1QTNF5), Ser16-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review