TLX3 (NM_021025) Human Mass Spec Standard

CAT#: PH305739

TLX3 MS Standard C13 and N15-labeled recombinant protein (NP_066305)

Product Images

Coomassie blue staining of purified TLX3 protein (Cat# TP305739). The protein was produced from HEK293T cells transfected with TLX3 cDNA clone (Cat# RC205739) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205739
• Predicted MW: 31.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205739 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPF
  EDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFT
  AAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQV
  KTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEED
  SSKVPAVTSLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066305
• RefSeq Size: 1513
• RefSeq ORF: 873
• Synonyms: HOX11L2; RNX
• Locus ID: 30012
• UniProt ID: O43711
• Cytogenetics: 5q35.1
• Summary: The protein encoded by this gene is an orphan homeobox protein that encodes a DNA-binding nuclear transcription factor. A translocation [t(5;14)(q35;q32)] involving this gene is associated with T-cell acute lymphoblastic leukemia (T-ALL) in children and young adults. [provided by RefSeq, Nov 2015]
• Protein Families: Transcription Factors