Asialoglycoprotein Receptor 1 (ASGR1) (NM_001671) Human Mass Spec Standard

CAT#: PH305686

ASGR1 MS Standard C13 and N15-labeled recombinant protein (NP_001662)

Product Images

Coomassie blue staining of purified ASGR1 protein (Cat# TP305686). The protein was produced from HEK293T cells transfected with ASGR1 cDNA clone (Cat# RC205686) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205686
• Predicted MW: 33.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205686 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEEL
  RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQ
  MAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNT
  WMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETE
  LDKASQEPPLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001662
• RefSeq Size: 1519
• RefSeq ORF: 873
• Synonyms: ASGPR; ASGPR1; CLEC4H1; HL-1
• Locus ID: 432
• UniProt ID: P17661, P07306, Q53SB5, Q6FGQ5
• Cytogenetics: 17p13.1
• Summary: This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the more abundant major subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
• Protein Families: Druggable Genome, Transmembrane