Aquaporin 1 (AQP1) (NM_198098) Human Mass Spec Standard

CAT#: PH305304

AQP1 MS Standard C13 and N15-labeled recombinant protein (NP_932766)

Product Images

Coomassie blue staining of purified AQP1 protein (Cat# TP305304). The protein was produced from HEK293T cells transfected with AQP1 cDNA clone (Cat# RC205304) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205304
• Predicted MW: 28.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205304 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTTVQDNVKVSLAFGLSIATLAQSVGHI
  SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG
  IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW
  IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_932766
• RefSeq Size: 2807
• RefSeq ORF: 807
• Synonyms: AQP-CHIP; CHIP28; CO
• Locus ID: 358
• UniProt ID: P29972, A0A024RA31
• Cytogenetics: 7p14.3
• Summary: This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane