MIF (NM_002415) Human Mass Spec Standard
CAT#: PH305106
MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205106 |
Predicted MW | 12.5 kDa |
Protein Sequence |
>RC205106 protein sequence
Red=Cloning site Green=Tags(s) MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002406 |
RefSeq Size | 561 |
RefSeq ORF | 345 |
Synonyms | GIF; GLIF; MMIF |
Locus ID | 4282 |
UniProt ID | P14174, I4AY87 |
Cytogenetics | 22q11.23 |
Summary | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Phenylalanine metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400864 | MIF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400864 | Transient overexpression lysate of macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
USD 436.00 |
|
TP305106 | Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 20 µg |
USD 867.00 |
|
TP721165 | Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review