Gemin 8 (GEMIN8) (NM_001042480) Human Mass Spec Standard
CAT#: PH304795
GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035945)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204795 |
Predicted MW | 28.6 kDa |
Protein Sequence |
>RC204795 protein sequence
Red=Cloning site Green=Tags(s) MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYLPSALLPQSSYDNEA AYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSRIQASTKEDQALSKEEEMETESDAEVECDLSNMEIT EELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYCNTRRSVEAPTERPGERRQAEMKRLYGDSAA KIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001035945 |
RefSeq Size | 3089 |
RefSeq ORF | 726 |
Synonyms | FAM51A1 |
Locus ID | 54960 |
UniProt ID | Q9NWZ8, A0A024RBX2 |
Cytogenetics | Xp22.2 |
Summary | The protein encoded by this gene is part of the SMN complex, which is necessary for spliceosomal snRNP assembly in the cytoplasm and pre-mRNA splicing in the nucleus. The encoded protein binds to both SMN1 and the GEMIN6/GEMIN7 heterodimer, mediating their interaction. This protein is found in nuclear Gemini of Cajal bodies (gems) and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413420 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420932 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420933 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413420 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 3 |
USD 436.00 |
|
LY420932 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 2 |
USD 436.00 |
|
LY420933 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 1 |
USD 436.00 |
|
PH300165 | GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035944) |
USD 3,255.00 |
|
PH313444 | GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_060326) |
USD 3,255.00 |
|
TP300165 | Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 2, 20 µg |
USD 867.00 |
|
TP304795 | Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 1, 20 µg |
USD 867.00 |
|
TP313444 | Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review