C1QB (NM_000491) Human Mass Spec Standard
CAT#: PH303821
C1QB MS Standard C13 and N15-labeled recombinant protein (NP_000482)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203821 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC203821 protein sequence
Red=Cloning site Green=Tags(s) MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGD HGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTI RFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTG GMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000482 |
RefSeq Size | 1044 |
RefSeq ORF | 759 |
Locus ID | 713 |
UniProt ID | P02746, A0A024RAB9 |
Cytogenetics | 1p36.12 |
Summary | This gene encodes the B-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis. [provided by RefSeq, Dec 2016] |
Protein Families | Secreted Protein |
Protein Pathways | Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424687 | C1QB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424687 | Transient overexpression lysate of complement component 1, q subcomponent, B chain (C1QB) |
USD 436.00 |
|
TP303821 | Recombinant protein of human complement component 1, q subcomponent, B chain (C1QB), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review