Biliverdin Reductase (BLVRA) (NM_000712) Human Mass Spec Standard

CAT#: PH303243

BLVRA MS Standard C13 and N15-labeled recombinant protein (NP_000703)

Product Images

Coomassie blue staining of purified BLVRA protein (Cat# TP303243). The protein was produced from HEK293T cells transfected with BLVRA cDNA clone (Cat# RC203243) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203243
• Predicted MW: 33.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203243 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNTEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEV
  AYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVSHEEHVELLMEEFAFLKKEV
  VGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKK
  SPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILH
  CLGLAEEIQKYCCSRK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000703
• RefSeq Size: 1094
• RefSeq ORF: 888
• Synonyms: BLVR; BVR; BVRA
• Locus ID: 644
• UniProt ID: P53004, A0A140VJF4
• Cytogenetics: 7p13
• Summary: The protein encoded by this gene belongs to the biliverdin reductase family, members of which catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH. Mutations in this gene are associated with hyperbiliverdinemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2011]
• Protein Pathways: Porphyrin and chlorophyll metabolism