Iba1 (AIF1) (NM_032955) Human Mass Spec Standard
CAT#: PH303154
AIF1 MS Standard C13 and N15-labeled recombinant protein (NP_116573)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203154 |
Predicted MW | 10.5 kDa |
Protein Sequence |
>RC203154 representing NM_032955
Red=Cloning site Green=Tags(s) MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMY EEKAREKEKPTGPPAKKAISELP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_116573 |
RefSeq Size | 503 |
RefSeq ORF | 279 |
Synonyms | AIF-1; IBA1; IRT-1; IRT1 |
Locus ID | 199 |
UniProt ID | P55008, I3WTX1 |
Cytogenetics | 6p21.33 |
Summary | This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409840 | AIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409840 | Transient overexpression lysate of allograft inflammatory factor 1 (AIF1), transcript variant 1 |
USD 436.00 |
|
TP303154 | Recombinant protein of human allograft inflammatory factor 1 (AIF1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP720891 | Purified recombinant protein of Human allograft inflammatory factor 1 (AIF1), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review