Lumican (LUM) (NM_002345) Human Mass Spec Standard
CAT#: PH302757
LUM MS Standard C13 and N15-labeled recombinant protein (NP_002336)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202757 |
Predicted MW | 38.4 kDa |
Protein Sequence |
>RC202757 protein sequence
Red=Cloning site Green=Tags(s) MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKY LYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLE DLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTL YLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYY LEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002336 |
RefSeq Size | 2116 |
RefSeq ORF | 1014 |
Synonyms | LDC; SLRR2D |
Locus ID | 4060 |
UniProt ID | P51884, A0A384N669 |
Cytogenetics | 12q21.33 |
Summary | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419389 | LUM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419389 | Transient overexpression lysate of lumican (LUM) |
USD 436.00 |
|
TP302757 | Recombinant protein of human lumican (LUM), 20 µg |
USD 867.00 |
|
TP720321 | Recombinant protein of human lumican (LUM) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review