EMP3 (NM_001425) Human Mass Spec Standard
CAT#: PH302216
EMP3 MS Standard C13 and N15-labeled recombinant protein (NP_001416)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202216 |
Predicted MW | 18.4 kDa |
Protein Sequence |
>RC202216 protein sequence
Red=Cloning site Green=Tags(s) MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLM VLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFA LAWVAFPLALVSGIIYIHLRKRE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001416 |
RefSeq Size | 850 |
RefSeq ORF | 489 |
Synonyms | YMP |
Locus ID | 2014 |
UniProt ID | P54852, A0A024QZF8 |
Cytogenetics | 19q13.33 |
Summary | The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400554 | EMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400554 | Transient overexpression lysate of epithelial membrane protein 3 (EMP3) |
USD 436.00 |
|
TP302216 | Recombinant protein of human epithelial membrane protein 3 (EMP3), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review