EMP3 (NM_001425) Human Mass Spec Standard

CAT#: PH302216

EMP3 MS Standard C13 and N15-labeled recombinant protein (NP_001416)

Product Images

Coomassie blue staining of purified EMP3 protein (Cat# TP302216). The protein was produced from HEK293T cells transfected with EMP3 cDNA clone (Cat# RC202216) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202216
• Predicted MW: 18.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202216 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLM
  VLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFA
  LAWVAFPLALVSGIIYIHLRKRE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001416
• RefSeq Size: 850
• RefSeq ORF: 489
• Synonyms: YMP
• Locus ID: 2014
• UniProt ID: P54852, A0A024QZF8
• Cytogenetics: 19q13.33
• Summary: The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
• Protein Families: Transmembrane