CD63 (NM_001780) Human Mass Spec Standard
CAT#: PH301733
CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201733 |
Predicted MW | 25.6 kDa |
Protein Sequence |
>RC201733 protein sequence
Red=Cloning site Green=Tags(s) MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA LGIAFVEVLGIVFACCLVKSIRSGYEVM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001771 |
RefSeq Size | 1032 |
RefSeq ORF | 714 |
Synonyms | LAMP-3; ME491; MLA1; OMA81H; TSPAN30 |
Locus ID | 967 |
UniProt ID | P08962, A0A024RB05 |
Cytogenetics | 12q13.2 |
Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419757 | CD63 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419757 | Transient overexpression lysate of CD63 molecule (CD63), transcript variant 1 |
USD 436.00 |
|
TP301733 | Recombinant protein of human CD63 molecule (CD63), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review