Thioredoxin 2 (TXN2) (NM_012473) Human Mass Spec Standard
CAT#: PH301666
TXN2 MS Standard C13 and N15-labeled recombinant protein (NP_036605)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201666 |
Predicted MW | 18.4 kDa |
Protein Sequence |
>RC201666 protein sequence
Red=Cloning site Green=Tags(s) MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDF QDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMK NGDVVDKFVGIKDEDQLEAFLKKLIG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036605 |
RefSeq Size | 1342 |
RefSeq ORF | 498 |
Synonyms | COXPD29; MT-TRX; MTRX; TRX2; TXN |
Locus ID | 25828 |
UniProt ID | Q99757 |
Cytogenetics | 22q12.3 |
Summary | This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402220 | TXN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402220 | Transient overexpression lysate of thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
TP301666 | Recombinant protein of human thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein, 20 µg |
USD 867.00 |
|
TP720159 | Recombinant protein of human thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review