POLR3GL (NM_032305) Human Mass Spec Standard

CAT#: PH300991

POLR3GL MS Standard C13 and N15-labeled recombinant protein (NP_115681)

Product Images

Coomassie blue staining of purified POLR3GL protein (Cat# TP300991). The protein was produced from HEK293T cells transfected with POLR3GL cDNA clone (Cat# RC200991) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200991
• Predicted MW: 25.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200991 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGA
  MRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKT
  TEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSD
  DNMDEAIY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115681
• RefSeq Size: 1191
• RefSeq ORF: 654
• Synonyms: flj32422; RPC32HOM
• Locus ID: 84265
• UniProt ID: Q9BT43
• Cytogenetics: 1q21.1
• Summary: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase