NPRL3 (NM_001039476) Human Mass Spec Standard

CAT#: PH300905

NPRL3 MS Standard C13 and N15-labeled recombinant protein (NP_001034565)

Product Images

Coomassie blue staining of purified NPRL3 protein (Cat# TP300905). The protein was produced from HEK293T cells transfected with NPRL3 cDNA clone (Cat# RC200905) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200905
• Predicted MW: 43.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200905 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADGNEGPQSPFHHILPKCKLARDLKEAYDSLCTSGVVRLHINSWLEVSFCLPHKIHYAASSLIPPEAIE
  RSLKAIRPYHALLLLSDEKSLLGELPIDCSPALVRVIKTTSAVKNLQQLAQDADLALLQVFQLAAHLVYW
  GKAIIIYPLCENNVYMLSPNASVCLYSPLAEQFSHQFPSHDLPSVLAKFSLPVSLSEFRNPLAPAVQETQ
  LIQMVVWMLQRRLLIQLHTYVCLMASPSEEEPRPREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTLT
  SPSMDNSSAELLPSGDSPLNQRMTENLLASLSEHERAAILSVPAAQNPEDLRMFARLLHYFRGRHHLEEI
  MYNENTRRSQLLMLFDKFRSVLVVTTHEDPVIAVFQALLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001034565
• RefSeq Size: 2840
• RefSeq ORF: 1170
• Synonyms: C16orf35; CGTHBA; FFEVF3; HS-40; MARE; NPR3; RMD11
• Locus ID: 8131
• UniProt ID: Q9BTE2
• Cytogenetics: 16p13.3
• Summary: The function of the encoded protein is not known. [provided by RefSeq, Aug 2011]