PPDPF (NM_024299) Human Mass Spec Standard
CAT#: PH300783
PPDPF MS Standard C13 and N15-labeled recombinant protein (NP_077275)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200783 |
Predicted MW | 11.8 kDa |
Protein Sequence |
>RC200783 protein sequence
Red=Cloning site Green=Tags(s) MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMAT VLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_077275 |
RefSeq Size | 794 |
RefSeq ORF | 342 |
Synonyms | C20orf149; dJ697K14.9; exdpf |
Locus ID | 79144 |
UniProt ID | Q9H3Y8 |
Cytogenetics | 20q13.33 |
Summary | Probable regulator of exocrine pancreas development.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411320 | PPDPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411320 | Transient overexpression lysate of pancreatic progenitor cell differentiation and proliferation factor homolog (zebrafish) (PPDPF) |
USD 436.00 |
|
TP300783 | Recombinant protein of human chromosome 20 open reading frame 149 (C20orf149), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review