Necdin (NDN) (NM_002487) Human Mass Spec Standard

CAT#: PH300448

NDN MS Standard C13 and N15-labeled recombinant protein (NP_002478)

Product Images

Coomassie blue staining of purified NDN protein (Cat# TP300448). The protein was produced from HEK293T cells transfected with NDN cDNA clone (Cat# RC200448) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200448
• Predicted MW: 36.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200448 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKAL
  QQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSIL
  RRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAV
  WNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA
  RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002478
• RefSeq Size: 1897
• RefSeq ORF: 963
• Synonyms: HsT16328; PWCR
• Locus ID: 4692
• UniProt ID: Q99608, X5D982
• Cytogenetics: 15q11.2
• Summary: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors