YKT6 (NM_006555) Human Mass Spec Standard
CAT#: PH300260
YKT6 MS Standard C13 and N15-labeled recombinant protein (NP_006546)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200260 |
Predicted MW | 22.4 kDa |
Protein Sequence |
>RC200260 protein sequence
Red=Cloning site Green=Tags(s) MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVKEQDYLCHVYV RNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMT KVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006546 |
RefSeq Size | 2783 |
RefSeq ORF | 594 |
Locus ID | 10652 |
UniProt ID | O15498, A4D2J0 |
Cytogenetics | 7p13 |
Summary | This gene product is one of the SNARE recognition molecules implicated in vesicular transport between secretory compartments. It is a membrane associated, isoprenylated protein that functions at the endoplasmic reticulum-Golgi transport step. This protein is highly conserved from yeast to human and can functionally complement the loss of the yeast homolog in the yeast secretory pathway. [provided by RefSeq, Jul 2008] |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416570 | YKT6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416570 | Transient overexpression lysate of YKT6 v-SNARE homolog (S. cerevisiae) (YKT6) |
USD 436.00 |
|
TP300260 | Recombinant protein of human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6), 20 µg |
USD 867.00 |
|
TP720932 | Purified recombinant protein of Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review