RBM23 (NM_018107) Human Mass Spec Standard
CAT#: PH300138
RBM23 MS Standard C13 and N15-labeled recombinant protein (NP_060577)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200138 |
Predicted MW | 46.8 kDa |
Protein Sequence |
>RC200138 protein sequence
Red=Cloning site Green=Tags(s) MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRR RNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSPVREPVD NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLAIGL TGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMK DSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGTDITFPDGDQELDLGSAGGR FQLMAKLAEGAGIQLPSTAAAAAAAAAAQAAALQLNGAVPLGALNPAALTALSPALNLASQCFQLSSLFT PQTM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060577 |
RefSeq Size | 2576 |
RefSeq ORF | 1272 |
Synonyms | CAPERbeta; PP239; RNPC4 |
Locus ID | 55147 |
UniProt ID | Q86U06, A0A0S2Z5J3 |
Cytogenetics | 14q11.2 |
Summary | This gene encodes a member of the U2AF-like family of RNA binding proteins. This protein interacts with some steroid nuclear receptors, localizes to the promoter of a steroid- responsive gene, and increases transcription of steroid-responsive transcriptional reporters in a hormone-dependent manner. It is also implicated in the steroid receptor-dependent regulation of alternative splicing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413294 | RBM23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421400 | RBM23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC421401 | RBM23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413294 | Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 2 |
USD 436.00 |
|
LY421400 | Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 1 |
USD 665.00 |
|
LY421401 | Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 3 |
USD 436.00 |
|
TP300138 | Recombinant protein of human RNA binding motif protein 23 (RBM23), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review