C14orf166 (RTRAF) (NM_016039) Human Mass Spec Standard

CAT#: PH300016

C14orf166 MS Standard C13 and N15-labeled recombinant protein (NP_057123)

Product Images

Coomassie blue staining of purified RTRAF protein (Cat# TP300016). The protein was produced from HEK293T cells transfected with RTRAF cDNA clone (Cat# RC200016) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200016
• Predicted MW: 28.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200016 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP
  FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL
  LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE
  ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057123
• RefSeq Size: 1064
• RefSeq ORF: 732
• Synonyms: C14orf166; CGI-99; CGI99; CLE; CLE7; hCLE; hCLE1; LCRP369; RLLM1
• Locus ID: 51637
• UniProt ID: Q9Y224, Q549M8
• Cytogenetics: 14q22.1
• Summary: RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:24608264).[UniProtKB/Swiss-Prot Function]